PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g042410.1
Common NameMTR_8g042410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB
Protein Properties Length: 547aa    MW: 61291.7 Da    PI: 5.1431
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g042410.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.7e-163986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed++lv++vk+ G g+W+++ +  g+ R++k+c++rw ++l
  Medtr8g042410.1 39 KGPWTSAEDDILVNYVKKNGEGNWNAVQKQTGLLRCGKSCRLRWANHL 86
                     79******************************99**********9986 PP

2Myb_DNA-binding52.31.3e-1692135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g +T+eE++l+ +++++lG++ W++ a++++ gRt++++k++w++
  Medtr8g042410.1  92 KGTFTAEEEQLICELHAKLGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9263486IPR017930Myb domain
SuperFamilySSF466896.36E-2938133IPR009057Homeodomain-like
SMARTSM007174.7E-133888IPR001005SANT/Myb domain
PfamPF002492.1E-143986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-224093IPR009057Homeodomain-like
CDDcd001674.75E-104186No hitNo description
PROSITE profilePS5129425.51787141IPR017930Myb domain
SMARTSM007173.0E-1691139IPR001005SANT/Myb domain
PfamPF002492.2E-1592135IPR001005SANT/Myb domain
CDDcd001671.24E-1194135No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2594140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MMRRMKKEIE DEMLDDDRIG SEFNDEEYDR SARGVLLKKG PWTSAEDDIL VNYVKKNGEG  60
NWNAVQKQTG LLRCGKSCRL RWANHLRPNL KKGTFTAEEE QLICELHAKL GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR HRAGLPLYPP EVLQQTLHGQ STDGINSGNK VHPDFLQKKN  180
FDIHDAIYDC MKDNQGMLPY VAELPDISAY SNMLNGFDSS QYSSFGQSTS SNHKHFRDST  240
IPFLDFSCID RNGYYPFDHI QDDTFYKWTQ SFGMQSPLHH AGPSSHSSMC YSHSLKNGNS  300
STSKPFEELP SIQYPETDLG SWGTSPPPPL LESVDDFIKS PTPISTLESD CSSPQNSGLL  360
QSVLYPRKTP SSSKNQFYGK SSNSSTATPG ERADSSALNM YDTEWEESAD PVSPFGTSSI  420
LNECPAVSAN RSSLDEQPPV HTVNGNTVKL EYVDPVWTPD SGNQITSLLN FSRPDFLLGS  480
DWYEQCSGND QNQSIFYDAT SMFLEDQSAT DYKHMTAGTS NPSQVREFGS CAWNNMPPVC  540
QVSDLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29371405107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013445158.10.0myb transcription factor
TrEMBLA0A072TNU80.0A0A072TNU8_MEDTR; Myb transcription factor
STRINGGLYMA13G25716.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-102myb domain protein 65
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]